PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi06g03570.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family TALE
Protein Properties Length: 266aa    MW: 30399.5 Da    PI: 7.5297
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi06g03570.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.99.5e-101952292155
                      HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
         Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                      k +yps+++++ LA+++gL+ +q+ +WF N+R ++
  Vradi06g03570.1 195 KWPYPSESQKQALAESTGLDLKQINNWFINQRKRH 229
                      569*****************************885 PP

2ELK38.72.1e-13149170122
              ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                      ELK qLlrKYsgyLgsLk+EF+
  Vradi06g03570.1 149 ELKVQLLRKYSGYLGSLKKEFL 170
                      9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012554.5E-155397IPR005540KNOX1
PfamPF037905.1E-195596IPR005540KNOX1
PfamPF037912.6E-5109125IPR005541KNOX2
PROSITE profilePS5121311.139149169IPR005539ELK domain
PfamPF037891.5E-9149170IPR005539ELK domain
SMARTSM011887.1E-7149170IPR005539ELK domain
PROSITE profilePS5007112.228169232IPR001356Homeobox domain
SuperFamilySSF466891.5E-19171243IPR009057Homeodomain-like
SMARTSM003892.8E-12171236IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.8E-28174235IPR009057Homeodomain-like
CDDcd000864.78E-13181233No hitNo description
PfamPF059202.1E-17189228IPR008422Homeobox KN domain
PROSITE patternPS000270207230IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MDMMNMETNR KFLSLPLSNN SGAQMRTDRR VPVATNSIAQ DHHYTHHNPT DTCSVRDKIM  60
AHPLFPRLLS SYLNCLKVGA PPEVVASLEE SCAKCESINA SSGRTGSGSI GEDPALDQFM  120
EAYCQSESSS QNEVDVHENN LDSQAEDREL KVQLLRKYSG YLGSLKKEFL KKKKNGKLPK  180
EARQQLLDWW NRHYKWPYPS ESQKQALAES TGLDLKQINN WFINQRKRHW KPSEDMQFAV  240
MDATNYYMEN VMCKPFPMDG MPMLL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1280611e-125EF128061.1 Medicago truncatula class I KNOX homeobox transcription factor (KNOX6) mRNA, complete cds.
GenBankGU4616041e-125GU461604.1 Medicago truncatula KNOX6 variant a mRNA, complete cds, alternatively spliced.
GenBankGU4616051e-125GU461605.1 Medicago truncatula KNOX6 variant b mRNA, complete cds, alternatively spliced.
GenBankGU4616061e-125GU461606.1 Medicago truncatula KNOX6 variant c mRNA, complete sequence, alternatively spliced.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014502681.10.0PREDICTED: homeobox protein SBH1-like isoform X1
RefseqXP_014502682.10.0PREDICTED: homeobox protein SBH1-like isoform X2
SwissprotP466082e-93HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLA0A0S3RK690.0A0A0S3RK69_PHAAN; Uncharacterized protein
STRINGGLYMA14G05150.21e-157(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-83KNOX/ELK homeobox transcription factor